FKBP25 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54354

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to FKBP3(FK506 binding protein 3, 25kDa) The peptide sequence was selected from the C terminal of FKBP3. Peptide sequence EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FKBP25 Antibody - BSA Free

Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354] - Human Hela, Antibody Dilution: 1.0 ug/ml FKBP3 is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354] - Human 721_B, Antibody Dilution: 1.0 ug/ml FKBP3 is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354] - Human MCF7, Antibody Dilution: 1.0 ug/ml FKBP3 is supported by BioGPS gene expression data to be expressed in MCF7.

Applications for FKBP25 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FKBP25

FKBP3 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP3 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.

Long Name

25 kDa FK506 Binding Protein

Alternate Names

FKBP3

Gene Symbol

FKBP3

UniProt

Additional FKBP25 Products

Product Documents for FKBP25 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FKBP25 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for FKBP25 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FKBP25 Antibody - BSA Free and earn rewards!

Have you used FKBP25 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...