FKBP52/FKBP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56131

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FKBP52 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE

Reactivity Notes

Mouse 81%, Rat 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FKBP52/FKBP4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: FKBP52/FKBP4 Antibody [NBP2-56131]

Immunocytochemistry/ Immunofluorescence: FKBP52/FKBP4 Antibody [NBP2-56131]

Immunocytochemistry/Immunofluorescence: FKBP52/FKBP4 Antibody [NBP2-56131] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.

Applications for FKBP52/FKBP4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FKBP52

Hsp90 is crucial to cellular signaling by its regulation of the folding, activity, and stability of a wide range of client proteins. These client protein complexes may also contain one or more cochaperones (1). One class of Hsp90-binding cochaperone is composed of proteins with a characteristic tetratricopeptide repeat (TPR) domain that forms an Hsp90 binding site. Among the TPR cochaperones of Hsp90 are Hop/Sti1, protein phosphatase PP5, and members of both the FK506- and cyclosporin Abinding families of immunophilins (2). FK506-binding protein 51 (FKBP51) and FKBP52 are large molecular weight immunophilins that are part of the mature glucocorticoid receptor (GR) heterocomplex (3). The N terminal domain of each protein binds FK506 and has peptidyl-prolyl isomerase (PPIase) activity that converts prolyl peptide bonds within target proteins from cis- to trans- proline. The C-terminal domains contain the TPR repeats involved in protein-protein interactions with the Hsp90 (4). Although FKBP52 and FKBP51 share approx. 75% sequence similarity, they affect hormone binding by glucocorticoid receptor in opposing manners and have different Hsp90- binding characteristics (3, 5). Also, whereas FKBP51 typically has a role with the progesterone receptor, FKBP52 has been found to be linked to the progesterone, androgen and glucocorticoid receptors (5).

Long Name

52 kDa FK506 Binding Protein

Alternate Names

FKBP4, FKBP59, HBI, Hsp56

Gene Symbol

FKBP4

Additional FKBP52 Products

Product Documents for FKBP52/FKBP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FKBP52/FKBP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Phosphatases and Regulators

Customer Reviews for FKBP52/FKBP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FKBP52/FKBP4 Antibody - BSA Free and earn rewards!

Have you used FKBP52/FKBP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies