Flavin containing monooxygenase 4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59353

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Flavin containing monooxygenase 4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to FMO4(flavin containing monooxygenase 4) The peptide sequence was selected from the N terminal of FMO4. Peptide sequence MVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Flavin containing monooxygenase 4 Antibody - BSA Free

Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-59353]

Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-59353]

Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-59353] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-59353]

Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-59353]

Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-59353] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-59353]

Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-59353]

Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-59353] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for Flavin containing monooxygenase 4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Flavin containing monooxygenase 4

FMO4 belongs to the FMO family. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics.

Alternate Names

dimethylaniline monooxygenase [N-oxide-forming] 4, Dimethylaniline oxidase 4, EC 1.14.13.8, flavin containing monooxygenase 4, FMO 4, FMO2, Hepatic flavin-containing monooxygenase 4

Gene Symbol

FMO4

UniProt

P31512 (Human)

Additional Flavin containing monooxygenase 4 Products

Product Documents for Flavin containing monooxygenase 4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Flavin containing monooxygenase 4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Flavin containing monooxygenase 4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Flavin containing monooxygenase 4 Antibody - BSA Free and earn rewards!

Have you used Flavin containing monooxygenase 4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies