FOXA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87461

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FOXA3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOXA3. Peptide sequence: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for FOXA3 Antibody - BSA Free

Western Blot: FOXA3 Antibody [NBP2-87461]

Western Blot: FOXA3 Antibody [NBP2-87461]

Western Blot: FOXA3 Antibody [NBP2-87461] - Host: Rabbit. Target Name: FOXA3. Sample Tissue: Mouse Skeletal Muscle. Antibody Dilution: 1ug/ml
Immunohistochemistry: FOXA3 Antibody [NBP2-87461]

Immunohistochemistry: FOXA3 Antibody [NBP2-87461]

Immunohistochemistry: FOXA3 Antibody [NBP2-87461] - Human Lung
Western Blot: FOXA3 Antibody [NBP2-87461]

Western Blot: FOXA3 Antibody [NBP2-87461]

Western Blot: FOXA3 Antibody [NBP2-87461] - WB Suggested Anti-FOXA3 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate

Applications for FOXA3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FOXA3

FOXA3 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.

Alternate Names

FKHH3, Fork head-related protein FKH H3, forkhead box A3, Forkhead box protein A3, hepatocyte nuclear factor 3, gamma, hepatocyte nuclear factor 3-gamma, HNF-3G, HNF-3-gamma, HNF3GTCF-3G, MGC10179, TCF3G, Transcription factor 3G

Gene Symbol

FOXA3

Additional FOXA3 Products

Product Documents for FOXA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FOXA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FOXA3 Antibody - BSA Free

Customer Reviews for FOXA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FOXA3 Antibody - BSA Free and earn rewards!

Have you used FOXA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies