FOXE3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10932

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FOXE3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FOXE3 (NP_036318). Peptide sequence PEPPCCAAPDAAAAAFPPCAAAASPPLYSQVPDRLVLPATRPGPGPLPAE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FOXE3 Antibody - BSA Free

Immunohistochemistry: FOXE3 Antibody [NBP3-10932]

Immunohistochemistry: FOXE3 Antibody [NBP3-10932]

Immunohistochemistry: FOXE3 Antibody [NBP3-10932] - Immunohistochemical analysis of human muscle.

Applications for FOXE3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FOXE3

This intronless gene belongs to the forkhead family of transcription factors, which is characterized by a distinctforkhead domain. The protein encoded functions as a lens-specific transcription factor and plays an important role invertebrate lens formation. Mutations in this gene are associated with anterior segment mesenchymal dysgenesis andcongenital primary aphakia. (provided by RefSeq)

Alternate Names

ASMD, FKHL12forkhead, drosophila, homolog-like 12, forkhead box E3, Forkhead-related protein FKHL12, Forkhead-related transcription factor 8, FREAC-8, FREAC8forkhead box protein E3

Gene Symbol

FOXE3

Additional FOXE3 Products

Product Documents for FOXE3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FOXE3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FOXE3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FOXE3 Antibody - BSA Free and earn rewards!

Have you used FOXE3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies