FoxH1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10476

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FoxH1 (NP_003914). Peptide sequence MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FoxH1 Antibody - BSA Free

Western Blot: FoxH1 Antibody [NBP3-10476]

Western Blot: FoxH1 Antibody [NBP3-10476]

Western Blot: FoxH1 Antibody [NBP3-10476] - Western blot analysis using NBP3-10476 on Human HT1080 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for FoxH1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FoxH1

Fas, also referred to as CD95 or APO-1, is a type I transmembrane protein that plays a central role mediating viral immunity. TIA-1 and TIAR are two closely related proteins that possess three RRMs (RNA recognition motifs), designated RRM 1, 2 and 3, respectively. Although both TIA-1 and TIAR are thought to function as mediators of apoptotic cell death, their specific roles in such pathways are unknown. Unlike TIA-1, which is found in the granules of cytotoxic lymphocytes, TIAR expression is limited to the nucleus and found in a much broader range of cells including, but not limited to, cells of hematopoietic origin. TIAR is translocated to the cytoplasm shortly after Fas ligation and this event immediately proceeds the onset of DNA fragmentation. A novel serine/ threonine kinase that is activated as a result of Fas ligation, designated FAST (Fas-activated serine/threonine), shows kinase specificity towards both TIA-1 and TIAR. In unstimulated Jurkat cells, FAST resides in the cytoplasm as a highly phosphorylated protein and is quickly dephosphorylated and activated in response to stimulated Fas.

Long Name

Forkhead Box J1

Alternate Names

FAST1

Gene Symbol

FOXH1

Additional FoxH1 Products

Product Documents for FoxH1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FoxH1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FoxH1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FoxH1 Antibody - BSA Free and earn rewards!

Have you used FoxH1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

TGF-beta Signaling Pathways
TGF-beta Signaling Pathway Thumbnail