FoxP2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86671
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Mouse, Rat
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Immunocytochemistry/ Immunofluorescence, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS
Reactivity Notes
Rat reactivity reported in scientific literature (PMID: 25926446). Mouse reactivity reported in scientific literature (PMID: 26407299).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for FoxP2 Antibody - BSA Free
Immunohistochemistry: FoxP2 Antibody [NBP1-86671]
FoxP2-Antibody-Immunohistochemistry-NBP1-86671-img0009.jpgImmunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671]
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671]
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human rectum shows moderate nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671]
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671]
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human skin shows moderate nuclear positivity in deep epidermal cells.Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] -
Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the PPC.A) TBR-1 heavily labeled cells in Layer 2 as well as scattered cells in Layer 3. As in the APC many cells in layers 2 & 3 exhibited the deep marker CTIP2 (B). Only widely scattered cells exhibited FOXP2 & DAARP 32 & NOR1 (B,C). The other three makers exhibited very different patterns: CUX 1 staining (E) was strong throughout layers 2 & 3, BRN2 staining much more modest in the same regions, CART was restricted to the middle of layer 2 (F). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] -
Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the OT.A) TBR-1 (A), BRN2 (D) & CART (E) were only found scattered in the very deepest regions of the OT. All four of the deep laminar markers heavily labeled the region. Both CTIP2 & FOXP2 cells were broadly present in Layer 2 & scattered in Layer 3 (Fig 6b). On the medial side most FOXP2 cells coexpressed CTIP2 but the percentage of cells with both markers was reduced laterally. DARRP-32 cells were dense on the lateral side near the APC & in deep regions of the OT, while NOR1 cells were found in Layer 2 in the medial OT (Fig 6c). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] -
Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the APC.A) TBR-1 heavily labeled cells in Layer 2 as well as scattered cells in Layer 3. Of the 4 deep layer markers (B,C), only CTIP2 exhibited dense staining. The other three (FOXP2, NOR1 & DAARP32) labeled sparse number in Layers 1–3. The dense staining for FOXP2 & DAARP32 seen at the bottom of the figures sharply demarcates the APC from the more ventral OT. The other three makers exhibited very different patterns: BRN2 staining was found more in the ventral APC (D), CUX 1 in the deeper portions of both Layer 2 & 3 (E), & CART in the middle of Layer 2(F). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] -
Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the AONpP.A). TBR1-labelled cells were found throughout Layer 2 of the AONpP as well as in the tenia tecta & mitral cell layer of the OB. B, C) Deep markers were differentially distributed in the region. Layer 2 exhibited dense & evenly-spread CTIP2-positive cells (Fig 3b), while NOR1 was found primarily in the dorsal portion of the structure (Fig 3c, top) Cells expressing the other two marker were rare & found primarily in layer 1: DARRP-32 (note dense staining in the glomerular layer of the OB at left, an area containing large numbers of dopaminergic interneurons, Fig 3c; Liu et al, 2013) & FOXP2 (most often found near the OB, Fig 3b). CTIP2 stained cells were also found in layer 1 but never in cells that expressed one of the other markers. The superficial markers were also differentially distributed. Both BRN2 (Fig 3d) & CUX1 (Fig 3e) were observed primarily in deep cells (except in pars medialis, where CUX1-labeled cells spanned the entire region) with highest densities in the region under the LOT (pars lateralis). All CUX1 cells also expressed BRN2, & over 90% of CUX1 & BRN2 cells also expressed CTIP2. The anti-BRN2 antibody also labeled the LOT (right) & RMS (core of the olfactory peduncle). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: FoxP2 Antibody - BSA Free [NBP1-86671]
Analysis in human cell line RH-30.Applications for FoxP2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
Reported in scientific literature (PMID: 25926446 and 25926446).
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200-1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: FoxP2
Long Name
Forkhead Box P2
Alternate Names
CAGH44, SPCH1, TNRC10
Gene Symbol
FOXP2
Additional FoxP2 Products
Product Documents for FoxP2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for FoxP2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for FoxP2 Antibody - BSA Free
Customer Reviews for FoxP2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review FoxP2 Antibody - BSA Free and earn rewards!
Have you used FoxP2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...