FoxP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86671

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 25926446). Mouse reactivity reported in scientific literature (PMID: 26407299).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FoxP2 Antibody - BSA Free

Immunohistochemistry: FoxP2 Antibody [NBP1-86671]

Immunohistochemistry: FoxP2 Antibody [NBP1-86671]

FoxP2-Antibody-Immunohistochemistry-NBP1-86671-img0009.jpg
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671]

Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671]

Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671]

Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671]

Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human rectum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671]

Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671]

Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671]

Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671]

Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human skin shows moderate nuclear positivity in deep epidermal cells.
FoxP2 Antibody

Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] -

Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the PPC.A) TBR-1 heavily labeled cells in Layer 2 as well as scattered cells in Layer 3. As in the APC many cells in layers 2 & 3 exhibited the deep marker CTIP2 (B). Only widely scattered cells exhibited FOXP2 & DAARP 32 & NOR1 (B,C). The other three makers exhibited very different patterns: CUX 1 staining (E) was strong throughout layers 2 & 3, BRN2 staining much more modest in the same regions, CART was restricted to the middle of layer 2 (F). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
FoxP2 Antibody

Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] -

Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the OT.A) TBR-1 (A), BRN2 (D) & CART (E) were only found scattered in the very deepest regions of the OT. All four of the deep laminar markers heavily labeled the region. Both CTIP2 & FOXP2 cells were broadly present in Layer 2 & scattered in Layer 3 (Fig 6b). On the medial side most FOXP2 cells coexpressed CTIP2 but the percentage of cells with both markers was reduced laterally. DARRP-32 cells were dense on the lateral side near the APC & in deep regions of the OT, while NOR1 cells were found in Layer 2 in the medial OT (Fig 6c). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
FoxP2 Antibody

Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] -

Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the APC.A) TBR-1 heavily labeled cells in Layer 2 as well as scattered cells in Layer 3. Of the 4 deep layer markers (B,C), only CTIP2 exhibited dense staining. The other three (FOXP2, NOR1 & DAARP32) labeled sparse number in Layers 1–3. The dense staining for FOXP2 & DAARP32 seen at the bottom of the figures sharply demarcates the APC from the more ventral OT. The other three makers exhibited very different patterns: BRN2 staining was found more in the ventral APC (D), CUX 1 in the deeper portions of both Layer 2 & 3 (E), & CART in the middle of Layer 2(F). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
FoxP2 Antibody

Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] -

Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the AONpP.A). TBR1-labelled cells were found throughout Layer 2 of the AONpP as well as in the tenia tecta & mitral cell layer of the OB. B, C) Deep markers were differentially distributed in the region. Layer 2 exhibited dense & evenly-spread CTIP2-positive cells (Fig 3b), while NOR1 was found primarily in the dorsal portion of the structure (Fig 3c, top) Cells expressing the other two marker were rare & found primarily in layer 1: DARRP-32 (note dense staining in the glomerular layer of the OB at left, an area containing large numbers of dopaminergic interneurons, Fig 3c; Liu et al, 2013) & FOXP2 (most often found near the OB, Fig 3b). CTIP2 stained cells were also found in layer 1 but never in cells that expressed one of the other markers. The superficial markers were also differentially distributed. Both BRN2 (Fig 3d) & CUX1 (Fig 3e) were observed primarily in deep cells (except in pars medialis, where CUX1-labeled cells spanned the entire region) with highest densities in the region under the LOT (pars lateralis). All CUX1 cells also expressed BRN2, & over 90% of CUX1 & BRN2 cells also expressed CTIP2. The anti-BRN2 antibody also labeled the LOT (right) & RMS (core of the olfactory peduncle). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
FoxP2 Antibody - BSA Free Western Blot: FoxP2 Antibody - BSA Free [NBP1-86671]

Western Blot: FoxP2 Antibody - BSA Free [NBP1-86671]

Analysis in human cell line RH-30.

Applications for FoxP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Reported in scientific literature (PMID: 25926446 and 25926446).

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FoxP2

FOXP2 encodes an evolutionarily conserved transcription factor expressed in fetal and adult brain. This transcription factor is a member of the forkhead/winged-helix (FOX) family of transcription factors, and contains a FOX DNA-binding domain and a large polyglutamine tract. Members of the FOX family of transcription factors are regulators of embryogenesis. The product of this gene is thought to be required for proper development of speech and language regions of the brain during embryogenesis. Although a point mutation in this gene has been associated with the KE pedigree segregating developmental verbal dyspraxia, no association between mutations in this gene and another speech disorder, autism, has been found. Four alternative transcripts encoding three different isoforms have been identified.

Long Name

Forkhead Box P2

Alternate Names

CAGH44, SPCH1, TNRC10

Gene Symbol

FOXP2

Additional FoxP2 Products

Product Documents for FoxP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FoxP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FoxP2 Antibody - BSA Free

Customer Reviews for FoxP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FoxP2 Antibody - BSA Free and earn rewards!

Have you used FoxP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...