FoxP3 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25325PEP

Novus Biologicals
Loading...

Key Product Details

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FoxP3

Source: E.coli

Amino Acid Sequence: GCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25325It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25325PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: FoxP3

Forkhead box P3 (FoxP3), aka Scurfin and JM2, is a protein involving in immune system responses and functioning as a transcriptional regulator crucial in the development and inhibitory of regulatory T-Cells (Treg). FoxP3 is a master regulator of the Treg lineage, who requires Ahr and STAT-5 and other additional transcription factors to retains its complete function and differentiation. Scurfin remains steady and constitutively expressed in two conditions: a high level in CD25 + CD4 positive regulatory T cells and a low level in CD4 positive/CD25 negative cells. JM2 is absent in CD4 negative/CD8 positive T cells. FoxP3 defects are related to various cancers and autoimmune diseases, and X-linked syndrome (IPEX), while overexpression may also cause severe immunodeficiency.

Long Name

Forkhead Box P3

Alternate Names

AIID, DIETER, IPEX, JM2, PIDX, SCURFIN, XPID

Gene Symbol

FOXP3

Additional FoxP3 Products

Product Documents for FoxP3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FoxP3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for FoxP3 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review FoxP3 Recombinant Protein Antigen and earn rewards!

Have you used FoxP3 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for FoxP3 Recombinant Protein Antigen

Showing  1 - 2 of 2 FAQs Showing All
  • Q: Does FoxP3 antibodies comes in lyophilized form?

    A: FoxP3 antibodies, aka JM2 IPEX, and Scurfin antibodies, have the following products in lyophilized form: NBP1-18319, AF3240.

  • Q: What the theoretical molecular weight for FoxP3 antibodies?

    A: The TMW of FoxP3 antibodies is approximately 47 - 52 kDa.

  • Q: Does FoxP3 antibodies comes in lyophilized form?

    A: FoxP3 antibodies, aka JM2 IPEX, and Scurfin antibodies, have the following products in lyophilized form: NBP1-18319, AF3240.

  • Q: What the theoretical molecular weight for FoxP3 antibodies?

    A: The TMW of FoxP3 antibodies is approximately 47 - 52 kDa.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Proteins and Enzymes