FOXS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84031

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FOXS1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of FOXS1. Peptide sequence: MQKQPSPESLAPSAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for FOXS1 Antibody - BSA Free

Western Blot: FOXS1 Antibody [NBP2-84031]

Western Blot: FOXS1 Antibody [NBP2-84031]

Western Blot: FOXS1 Antibody [NBP2-84031] - WB Suggested Anti-Fkhl18 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Mouse Liver

Applications for FOXS1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FOXS1

The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown.

Alternate Names

FKHL18, forkhead (Drosophila)-like 18, forkhead box protein S1, forkhead box S1, Forkhead-like 18 protein, forkhead-related activator 10, Forkhead-related transcription factor 10, forkhead-related transcription factor FREAC-10, FREAC-10, FREAC10forkhead-like 18 (Drosophila), MGC4544

Gene Symbol

FOXS1

Additional FOXS1 Products

Product Documents for FOXS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FOXS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FOXS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FOXS1 Antibody - BSA Free and earn rewards!

Have you used FOXS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies