FSD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09408

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FSD1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FSD1. Peptide sequence FKTRFTQPLLPAFTVWCGSFQVTTGLQVPSAVRCLQKRGSATSSSNTSLT

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FSD1 Antibody - BSA Free

Western Blot: FSD1 Antibody [NBP3-09408]

Western Blot: FSD1 Antibody [NBP3-09408]

Western Blot: FSD1 Antibody [NBP3-09408] - Western blot analysis of FSD1 in 721_B Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for FSD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FSD1

FSD1 is a protein with microtubule binding activity which is located at the centrosome and is related to MID1/midin.

Alternate Names

fibronectin type 3 and SPRY domain containing 1, fibronectin type III and SPRY domain containing 1, fibronectin type III and SPRY domain-containing protein 1, GLFNDfibronectin type 3 and SPRY (spla, ryanodine) domain containing (withcoiled-coil motif) 1, MGC3213, Microtubule-associated protein GLFND, midline 1-related protein 1, MIR1MID1-related protein 1

Gene Symbol

FSD1

Additional FSD1 Products

Product Documents for FSD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FSD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FSD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FSD1 Antibody - BSA Free and earn rewards!

Have you used FSD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies