FSH beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57723

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FSH beta Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGK

Reactivity Notes

Mouse 87%, Rat 85%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit FSH beta Antibody - BSA Free (NBP2-57723) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for FSH beta Antibody - BSA Free

Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723]

Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723]

Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723] - Staining of human pituitary gland shows moderate to strong cytoplasmic positivity in glandular cells in anterior lobe.
Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723]

Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723]

Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723]

Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723]

Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for FSH beta Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FSH beta

FSH is a pituitary hormone involved in the maturation of ovarian follicles and estrogen secretion in females. In the pituitary gland, FSH is produced by gonadotrophs. In males, FSH stimulates the secretion of testosterone. Follicle stimulating hormone enables ovarian folliculogenesis to the antral follicle stage and is essential for Sertoli cell proliferation and maintenance of sperm quality in the testis. Members of the pituitary glycoprotein hormone family, of which FSH is one (see also luteinizing hormone, chorionic gonadotropin, and thyroid stimulating hormone), consist of a shared alpha chain and a beta chain encoded by a separate gene.

Long Name

Follicle Stimulating Hormone, beta

Alternate Names

Follitropin, FSHB

Gene Symbol

FSHB

Additional FSH beta Products

Product Documents for FSH beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FSH beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FSH beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FSH beta Antibody - BSA Free and earn rewards!

Have you used FSH beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies