FTO Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-58941PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to FTO.

Source: E. coli

Amino Acid Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58941.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-58941PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: FTO

Fat mass and obesity-associated protein (FTO) is a novel protein and a member of the non-heme dioxygenase (Fe(II)- and 2-oxoglutarate-dependent dioxygenases) superfamily. Though not much is yet known about FTO, it is thought that the protein may somehow modify the activity of genes involved in metabolism and fat storage, which in turn may influence a person's risk of obesity.

FTO antibodies are useful tools for lipid metabolism research and obesity studies.

Long Name

Fat Mass and Obesity Associated

Alternate Names

Alpha-ketoglutarate-dependent dioxygenase FTO

Gene Symbol

FTO

Additional FTO Products

Product Documents for FTO Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FTO Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for FTO Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review FTO Recombinant Protein Antigen and earn rewards!

Have you used FTO Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for FTO Recombinant Protein Antigen

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Do you have any antibodies against FTO, where you can indicate the sequence of the immunogen?

    A: With regards to other FTO antibodies that we do list the peptide sequence for, the immunogen sequence for catalog number NB110-60935 can be found in the range of amino acids 400-505. Many of the exact immunogen sequences used for our products are proprietary and cannot be disclosed. In these instances we try to provide a reasonable amino acid range to help in your decision.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...