FTSJ1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52940

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FTSJ1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to FTSJ1(FtsJ homolog 1 (E. coli)) The peptide sequence was selected from the N terminal of FTSJ1. Peptide sequence MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FTSJ1 Antibody - BSA Free

Western Blot: FTSJ1 Antibody [NBP1-52940]

Western Blot: FTSJ1 Antibody [NBP1-52940]

Western Blot: FTSJ1 Antibody [NBP1-52940] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for FTSJ1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FTSJ1

FTSJ1 is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA.The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Alternate Names

CDLIV, cell division protein, EC 2.1.1.-, FtsJ homolog 1 (E. coli), JM23, mental retardation, X-linked 44, mental retardation, X-linked 9, MRX44, Protein ftsJ homolog 1, putative ribosomal RNA methyltransferase 1, rRNA (uridine-2'-O-)-methyltransferase, SPB1MRX9, TRM7

Gene Symbol

FTSJ1

UniProt

Q8IYT2 (Human)

Additional FTSJ1 Products

Product Documents for FTSJ1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FTSJ1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FTSJ1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FTSJ1 Antibody - BSA Free and earn rewards!

Have you used FTSJ1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies