Fucosyltransferase 1/FUT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57016

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Fucosyltransferase 1/FUT1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to Fucosyltransferase 1/FUT1 (fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)) The peptide sequence was selected from the middle region of Fucosyltransferase 1/FUT1 (NP_000139). Peptide sequence EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Fucosyltransferase 1/FUT1 Antibody - BSA Free

Western Blot: Fucosyltransferase 1/FUT1 Antibody [NBP1-57016]

Western Blot: Fucosyltransferase 1/FUT1 Antibody [NBP1-57016]

Western Blot: Blood group H inhibitor Antibody [NBP1-57016] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for Fucosyltransferase 1/FUT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Fucosyltransferase 1/FUT1

The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.

Alternate Names

2-alpha-L-fucosyltransferase, Alpha(1,2)FT 1, FUT1

Entrez Gene IDs

2523 (Human)

Gene Symbol

FUT1

UniProt

P19526

Additional Fucosyltransferase 1/FUT1 Products

Product Documents for Fucosyltransferase 1/FUT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Fucosyltransferase 1/FUT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glycobiology-related Enzymes

Customer Reviews for Fucosyltransferase 1/FUT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Fucosyltransferase 1/FUT1 Antibody - BSA Free and earn rewards!

Have you used Fucosyltransferase 1/FUT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies