Fucosyltransferase 3/FUT3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98488

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is FUT3/Blood Group Lewis A - C-terminal region. Peptide sequence: RSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Fucosyltransferase 3/FUT3 Antibody - BSA Free

Western Blot: Fucosyltransferase 3/FUT3 Antibody [NBP1-98488]

Western Blot: Fucosyltransferase 3/FUT3 Antibody [NBP1-98488]

Western Blot: Fucosyltransferase 3/FUT3 Antibody [NBP1-98488] - Human Fetal kidney Lysate, concentration 1 ug/ml.

Applications for Fucosyltransferase 3/FUT3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Fucosyltransferase 3/FUT3

The Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis, inflammation, and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a member of the fucosyltransferase family, which catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. It encodes an enzyme with alpha(1,3)-fucosyltransferase and alpha(1,4)-fucosyltransferase activities. Mutations in this gene are responsible for the majority of Lewis antigen-negative phenotypes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene.

Alternate Names

CD174, FT3B, FucT-III, FUT3, Les, Lewis FT

Gene Symbol

FUT3

Additional Fucosyltransferase 3/FUT3 Products

Product Documents for Fucosyltransferase 3/FUT3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fucosyltransferase 3/FUT3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Fucosyltransferase 3/FUT3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Fucosyltransferase 3/FUT3 Antibody - BSA Free and earn rewards!

Have you used Fucosyltransferase 3/FUT3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...