FUS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89812

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FUS2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FUS2 Antibody - BSA Free

Immunohistochemistry-Paraffin: FUS2 Antibody [NBP1-89812]

Immunohistochemistry-Paraffin: FUS2 Antibody [NBP1-89812]

Immunohistochemistry-Paraffin: FUS2 Antibody [NBP1-89812] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
FUS2 Antibody - BSA Free Western Blot: FUS2 Antibody - BSA Free [NBP1-89812]

Western Blot: FUS2 Antibody - BSA Free [NBP1-89812]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
FUS2 Antibody - BSA Free Western Blot: FUS2 Antibody - BSA Free [NBP1-89812]

Western Blot: FUS2 Antibody - BSA Free [NBP1-89812]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for FUS2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FUS2

Vertebrate FUS2 genes, which are known to be putative tumor suppressor gene, contain several important domains such as the catalytic N-acetyltransferase (NAT) domain. NAT domain is essential enzymes involved in several sophisticated cellular processes such as N-acetylation, O-acetylatin. NAT enzymes may be involved in susceptibility to cancer including colorectal cancer because of the presence of carcinogenic heterocyclic amines in some cooked foods. FUS2 was physically localized to the cytoplasm. Also, FUS2 showed the actin dependent movement, closely related to the polarization in the budding yeast, Saccharomyces cerevisiae.

Alternate Names

FUS-2, FUS2EC 2.3.1.-, N-acetyltransferase 6, N-acetyltransferase 6 (GCN5-related), Protein fus-2, Protein fusion-2

Gene Symbol

NAA80

Additional FUS2 Products

Product Documents for FUS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FUS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FUS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FUS2 Antibody - BSA Free and earn rewards!

Have you used FUS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies