FZR1/CDH1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56976

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FZR1/CDH1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to FZR1/CDH1 (fizzy/cell division cycle 20 related 1 (Drosophila)) The peptide sequence was selected from the N terminal of FZR1/CDH1. Peptide sequence SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FZR1/CDH1 Antibody - BSA Free

Western Blot: FZR1/CDH1 Antibody [NBP1-56976]

Western Blot: FZR1/CDH1 Antibody [NBP1-56976]

Western Blot: FZR1/CDH1 Antibody [NBP1-56976] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: FZR1/CDH1 Antibody [NBP1-56976]

Western Blot: FZR1/CDH1 Antibody [NBP1-56976]

Western Blot: FZR1/CDH1 Antibody [NBP1-56976] - FZR1/CDH1 Antibody 721_B cell lysate, concentration 0.2-1 ug/ml.
Western Blot: FZR1/CDH1 Antibody [NBP1-56976]

Western Blot: FZR1/CDH1 Antibody [NBP1-56976]

Western Blot: FZR1/CDH1 Antibody [NBP1-56976] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: FZR1/CDH1 Antibody [NBP1-56976]

Western Blot: FZR1/CDH1 Antibody [NBP1-56976]

Western Blot: FZR1/CDH1 Antibody [NBP1-56976] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: FZR1/CDH1 Antibody [NBP1-56976]

Western Blot: FZR1/CDH1 Antibody [NBP1-56976]

Western Blot: FZR1/CDH1 Antibody [NBP1-56976] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for FZR1/CDH1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FZR1/CDH1

FZR1/CDH1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1/CDH1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1/CDH1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.

Alternate Names

CDC20C, CDH1, Cdh1/Hct1 homolog, CDH1CDC20-like 1b, fizzy/cell division cycle 20 related 1 (Drosophila), Fzr, FZR2, FZRCDC20-like protein 1, hCDH1, HCDHFYR, KIAA1242fizzy-related protein homolog

Gene Symbol

FZR1

UniProt

Q9UM11 (Human)

Additional FZR1/CDH1 Products

Product Documents for FZR1/CDH1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FZR1/CDH1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FZR1/CDH1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FZR1/CDH1 Antibody - BSA Free and earn rewards!

Have you used FZR1/CDH1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies