G gamma14 Antibody (1G11-C7) - Azide and BSA Free

Novus Biologicals | Catalog # H00002793-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1G11-C7

Format

Azide and BSA Free
View all G gamma14 Primary Antibodies »

Product Specifications

Immunogen

GNGT2 (AAH08663, 1 a.a. ~ 69 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS

Specificity

GNGT2 - guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for G gamma14 Antibody (1G11-C7) - Azide and BSA Free

Sandwich ELISA: G gamma14 Antibody (1G11-C7) [H00002793-M01] - Detection limit for recombinant GST tagged GNGT2 is approximately 0.03ng/ml as a capture antibody.

Applications for G gamma14 Antibody (1G11-C7) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: G gamma14

Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene.

Alternate Names

G protein cone gamma 8 subunit, gamma-T2 subunit, G-gamma-8, G-gamma-9, G-GAMMA-C, GNG8, GNG9G gamma-C, GNGT8, guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 2, guanine nucleotide binding protein gamma 9, Guanine nucleotide binding protein gamma transducing activity polypeptide 2, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2

Entrez Gene IDs

2793 (Human)

Gene Symbol

GNGT2

OMIM

603655 (Human)

UniProt

AAH08663 (Human)

Additional G gamma14 Products

Product Documents for G gamma14 Antibody (1G11-C7) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for G gamma14 Antibody (1G11-C7) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for G gamma14 Antibody (1G11-C7) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review G gamma14 Antibody (1G11-C7) - Azide and BSA Free and earn rewards!

Have you used G gamma14 Antibody (1G11-C7) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies