G Protein alpha z Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-02979

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 250-350 of human G Protein alpha z (NP_002064.1). LFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for G Protein alpha z Antibody - Azide and BSA Free

Western Blot: G Protein alpha z AntibodyAzide and BSA Free [NBP3-02979]

Western Blot: G Protein alpha z AntibodyAzide and BSA Free [NBP3-02979]

Western Blot: G Protein alpha z Antibody [NBP3-02979] - Analysis of extracts of various cell lines, using G Protein alpha z antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit

Applications for G Protein alpha z Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: G Protein alpha z

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site. G protein z alpha, encoded by the GNAZ gene, is enriched in neural tissue and differs in sequence from other G alpha subunits. Alpha Subunits are encoded in 15 genes and several transcripts are alternatively spliced. Receptors may discriminate between splice variants; whether splice variants are functionally different in regulating effectors is not known. All alpha subunits appear to be palmitoylated near the N-terminus.

Alternate Names

G(x) alpha chain, guanine nucleotide binding protein (G protein), alpha z polypeptide, guanine nucleotide-binding protein G(z) subunit alpha, gz-alpha, transducin alpha

Gene Symbol

GNAZ

Additional G Protein alpha z Products

Product Documents for G Protein alpha z Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for G Protein alpha z Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for G Protein alpha z Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review G Protein alpha z Antibody - Azide and BSA Free and earn rewards!

Have you used G Protein alpha z Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...