G3BP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82976

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Proximity Ligation Assay, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all G3BP2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25893917).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for G3BP2 Antibody - BSA Free

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976]

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976]

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Analysis in human cerebral cortex and skin tissues using NBP1-82976 antibody. Corresponding G3BP2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976]

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976]

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human cerebellum, cerebral cortex, skin and testis using Anti-G3BP2 antibody NBP1-82976 (A) shows similar protein distribution across tissues to independent antibody NBP1-82977 (B).
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976]

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976]

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976]

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976]

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976]

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976]

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human skin shows very weak cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976]

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976]

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and in molecular layer.
G3BP2 Antibody - BSA Free

Western Blot: G3BP2 Antibody - BSA Free [NBP1-82976] -

NCAP interacts with SG proteins. (A) Interaction of NCAP with G3BP1, G3BP2, YTHDF3, USP10 and PKR. A549 cells transfected with GFP‐NCAP were unstressed, treated with arsenite or heat shock and subjected to co‐IP using anti‐His antibodies. The pulldown samples and total cell lysates were subjected to western blotting with indicated antibodies. (B) NCAP reduces global protein synthesis in A549 cells as measured by the Click chemistry‐AHA method (see Methods for more details). Ponceau staining and actin were used as loading controls. (C) NCAP does not affect the phosphorylation of eIF2 alpha. A549 cells transfected with GFP‐NCAP were untreated, treated with arsenite or heat shock and subjected to western blotting with antibodies against p‐eIF2 alpha, eIF2 alpha, NCAP and ACTIN. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34780058), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for G3BP2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 5 using NBP1-82976 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: G3BP2

Ras-GAP SH3 domain binding protein (G3BP2) contains an RNA recognition motif (RRM) and an N-terminal nuclear transport factor 2-like (NTF2-like) domain. The G3BP family of proteins have been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation.G3BP2 can interact with IkappaBalpha and IkappaBalpha/NFkappaB complexes. In this complex G3B2 is proposed to play a role in regulating the nucleocytoplasmic localization of NFkappaB as well as its activity.

Alternate Names

G3BP-2, GAP SH3 domain-binding protein 2, GTPase activating protein (SH3 domain) binding protein 2, KIAA0660, ras GTPase-activating protein-binding protein 2, Ras-GTPase activating protein SH3 domain-binding protein 2

Gene Symbol

G3BP2

Additional G3BP2 Products

Product Documents for G3BP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for G3BP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for G3BP2 Antibody - BSA Free

Customer Reviews for G3BP2 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used G3BP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • G3BP2 Antibody
    Name: Anonymous
    Application: Immunofluorescence
    Sample Tested: Cortical neurons
    Species: Mouse
    Verified Customer | Posted 09/01/2017
    G3BP2 staning is detected in neurites and cell bodies in mouse cortical neuros (dilution: 1:500 [red], DAPI: blue).
    G3BP2 Antibody - BSA Free NBP1-82976

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies