G6b/C6orf25 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57672

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all G6b Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGR

Reactivity Notes

Mouse (82%), Rat (85%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit G6b/C6orf25 Antibody - BSA Free (NBP2-57672) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for G6b/C6orf25 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: G6b/C6orf25 Antibody [NBP2-57672]

Immunocytochemistry/ Immunofluorescence: G6b/C6orf25 Antibody [NBP2-57672]

Immunocytochemistry/Immunofluorescence: G6b/C6orf25 Antibody [NBP2-57672] - Staining of human cell line HaCaT shows localization to the Golgi apparatus. Antibodey staining is shown in green.

Applications for G6b/C6orf25 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: G6b

C6orf25 is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Long Name

Glycoprotein VI [Platelet]

Alternate Names

C6orf25, NG31

Gene Symbol

MPIG6B

Additional G6b Products

Product Documents for G6b/C6orf25 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for G6b/C6orf25 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for G6b/C6orf25 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review G6b/C6orf25 Antibody - BSA Free and earn rewards!

Have you used G6b/C6orf25 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies