G6PC Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80533

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide corresponding to aa 10-59 in the N-terminal region of mouse G6PC (NP_032087). Peptide sequence DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24755741).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for G6PC Antibody - BSA Free

Western Blot: G6PC Antibody [NBP1-80533]

Western Blot: G6PC Antibody [NBP1-80533]

Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml
Western Blot: G6PC Antibody [NBP1-80533]

Western Blot: G6PC Antibody [NBP1-80533]

Western Blot: G6PC Antibody [NBP1-80533] - Mouse Intestine, concentration 1 ug/ml.
Western Blot: G6PC Antibody [NBP1-80533]

Western Blot: G6PC Antibody [NBP1-80533]

Western Blot: G6PC Antibody [NBP1-80533] - Sample Tissue: Mouse Lung Antibody Dilution: 1.0ug/ml
Western Blot: G6PC Antibody [NBP1-80533]

Western Blot: G6PC Antibody [NBP1-80533]

Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Liver. Antibody Dilution: 1ug/ml
G6PC Antibody - BSA Free

Western Blot: G6PC Antibody - BSA Free [NBP1-80533] -

5-Aminoimidazole-4-carboxamide1-b-D-ribofuranoside (AIACR) and compound C could regulate the AMPK signalling pathway under empagliflozin treatment in vitro. HL7702 cells were treated with the AMPK agonist AICAR and empagliflozin and PA. (A) Glucose production levels (n = 3 samples/group). (B) PEPCK and G6Pase activities (n = 3 samples/group). (C) Relative protein expression levels of p-AMPK, AMPK, p-GSK3 beta, GSK3 beta, p-CREB, CREB, PEPCK, and G6PASE were determined by western blotting. (D) Protein quantitative statistics (n = 3 samples/group). *P < 0.05, PA vs. PA+Empa; #P < 0.05, PA vs. PA+AIACR. HL7702 cells were treated with the AMPK inhibitor compound C and empagliflozin and PA. (E) Glucose production levels (n = 3 samples/group). (F) PEPCK and G6Pase activities (n = 3 samples/group). (G) Relative protein expression levels of p-AMPK, AMPK, p-GSK3 beta, GSK3 beta, p-CREB, CREB, PEPCK, and G6PASE were determined by western blotting. (H) Protein quantitative statistics (n = 3 samples/group). *P < 0.05, PA vs. PA+Empa; #P < 0.05, PA+Empa vs. PA+Empa+Compound C. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35299662), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
G6PC Antibody - BSA Free

Western Blot: G6PC Antibody - BSA Free [NBP1-80533] -

5-Aminoimidazole-4-carboxamide1-b-D-ribofuranoside (AIACR) and compound C could regulate the AMPK signalling pathway under empagliflozin treatment in vitro. HL7702 cells were treated with the AMPK agonist AICAR and empagliflozin and PA. (A) Glucose production levels (n = 3 samples/group). (B) PEPCK and G6Pase activities (n = 3 samples/group). (C) Relative protein expression levels of p-AMPK, AMPK, p-GSK3 beta, GSK3 beta, p-CREB, CREB, PEPCK, and G6PASE were determined by western blotting. (D) Protein quantitative statistics (n = 3 samples/group). *P < 0.05, PA vs. PA+Empa; #P < 0.05, PA vs. PA+AIACR. HL7702 cells were treated with the AMPK inhibitor compound C and empagliflozin and PA. (E) Glucose production levels (n = 3 samples/group). (F) PEPCK and G6Pase activities (n = 3 samples/group). (G) Relative protein expression levels of p-AMPK, AMPK, p-GSK3 beta, GSK3 beta, p-CREB, CREB, PEPCK, and G6PASE were determined by western blotting. (H) Protein quantitative statistics (n = 3 samples/group). *P < 0.05, PA vs. PA+Empa; #P < 0.05, PA+Empa vs. PA+Empa+Compound C. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35299662), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for G6PC Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 4 using NBP1-80533 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: G6PC

Glucose-6-phosphatase is an integral membrane protein of the endoplasmic reticulum that catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate. It is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Defects in the enzyme cause glycogen storage disease type I (von Gierke disease). [provided by RefSeq]

Alternate Names

EC 3.1.3.9, G6Pase, G-6-Pase, G6Pase-alpha, G6PT, glucose-6-phosphatase, Glucose-6-phosphatase alpha, glucose-6-phosphatase, catalytic (glycogen storage disease type I, von Gierkedisease), glucose-6-phosphatase, catalytic subunit, GSD1, GSD1a, MGC163350

Entrez Gene IDs

2538 (Human); 14377 (Mouse)

Gene Symbol

G6PC1

UniProt

Additional G6PC Products

Product Documents for G6PC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for G6PC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for G6PC Antibody - BSA Free

Customer Reviews for G6PC Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used G6PC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • G6PC Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: mouse liver
    Species: Mouse
    Verified Customer | Posted 10/15/2018
    Mouse liver samples, 1:500 dilution
    G6PC Antibody - BSA Free NBP1-80533

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...