G9a/EHMT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10942

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human

Applications

Western Blot, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all G9a/EHMT2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human G9a/EHMT2 (NP_006700). Peptide sequence VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

132 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for G9a/EHMT2 Antibody - BSA Free

Chromatin Immunoprecipitation: G9a/EHMT2 Antibody [NBP3-10942] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Applications for G9a/EHMT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: G9a/EHMT2

G9A antibody contains ankyrin repeats, suggesting involvement in intracellular protein-protein interaction. G9A is a histone methyltransferase that preferentially methylates Lys-9 of histone H3 and Lys-27 of histone H3 (in vitro). H3 Lys-9 methylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. G9A is probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1.

Long Name

G9a Histone Methyltransferase/Euchromatic Histone-lysine N-methyltransferase 2

Alternate Names

EHMT2

Gene Symbol

EHMT2

Additional G9a/EHMT2 Products

Product Documents for G9a/EHMT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for G9a/EHMT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Epigenetics
Notch Pathway

Customer Reviews for G9a/EHMT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review G9a/EHMT2 Antibody - BSA Free and earn rewards!

Have you used G9a/EHMT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Notch Signaling Pathways Notch Signaling Pathway Thumbnail