GAB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-05066

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GAB1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 594-694 of human GAB1 (NP_002030.2). PNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GAB1 Antibody - BSA Free

Western Blot: GAB1 AntibodyAzide and BSA Free [NBP3-05066]

Western Blot: GAB1 AntibodyAzide and BSA Free [NBP3-05066]

Western Blot: GAB1 Antibody [NBP3-05066] - Western blot analysis of extracts of SH-SY5Y cells, using GAB1 antibody (NBP3-05066) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 80s.

Applications for GAB1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GAB1

Growth factor triggering of protein tyrosine kinase receptors induces signals that cascade to the nucleus, activating mitogenic as well as other responses. Critical components of this process include adapter protein such as Shc, IRS-1 and Gab 1 (GRB-associated binder-1) that lack detectable catalytic activity. These are immediate substrates of receptor tyrosine kinase activity and serve to link activated receptors to downstream signaling components. Whereas Shc has been implicated in signaling by diverse receptor families, IRS-1 serves primarily as the major insulin receptor substrate. Shc and Gab 1 also participate in insulin signaling by linking the insulin receptor to Ras by forming complexes with GRB2 (another adapter protein) and Sos independently of IRS-1. Gab 1 is also thought to be involved in the EGF receptor signaling pathway.

Long Name

GRB2-associated Binding Protein 1

Alternate Names

GRB2-associated binder 1, GRB2-associated binding protein 1, GRB2-associated-binding protein 1, Growth factor receptor bound protein 2-associated protein 1

Gene Symbol

GAB1

Additional GAB1 Products

Product Documents for GAB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GAB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for GAB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GAB1 Antibody - BSA Free and earn rewards!

Have you used GAB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies