GABA-A R beta 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82224

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GABA-A R beta 2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GABA-A R beta 2. Peptide sequence: MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GABA-A R beta 2 Antibody - BSA Free

Western Blot: GABA-A R beta 2 Antibody [NBP2-82224]

Western Blot: GABA-A R beta 2 Antibody [NBP2-82224]

Western Blot: GABA-A R beta 2 Antibody [NBP2-82224] - WB Suggested Anti-GABRB2 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate

Applications for GABA-A R beta 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GABA-A R beta 2

GABA (A) receptors are ligand-gated chloride channels that play a role as inhibitory neurotransmitters. They are known targets for certain classes of environmental and pharmaceutical compounds because a number of drugs interact with binding sites on GABA (A). Some of these drugs include benzodiazepines, anticonvulsants, and anesthetics. GABA (A) Receptors are comprised of subunits and these are further classified into 3 major groups (alpha, beta, and gamma). The subunits determine the pharmacological characteristics.

Long Name

gamma-Aminobutyric Acid Type A Receptor, beta-2 Polypeptide

Alternate Names

GABAAR beta 2, GABAARb2, GABRB2

Gene Symbol

GABRB2

Additional GABA-A R beta 2 Products

Product Documents for GABA-A R beta 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GABA-A R beta 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

GABA Receptors

Customer Reviews for GABA-A R beta 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GABA-A R beta 2 Antibody - BSA Free and earn rewards!

Have you used GABA-A R beta 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies