GADD153/CHOP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49550

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GADD153 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ

Reactivity Notes

Mouse (84%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GADD153/CHOP Antibody - BSA Free

Immunohistochemistry-Paraffin: GADD153/CHOP Antibody [NBP2-49550]

Immunohistochemistry-Paraffin: GADD153/CHOP Antibody [NBP2-49550]

Immunohistochemistry-Paraffin: GADD153/CHOP Antibody [NBP2-49550] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: GADD153/CHOP Antibody [NBP2-49550]

Immunohistochemistry-Paraffin: GADD153/CHOP Antibody [NBP2-49550]

Immunohistochemistry-Paraffin: GADD153/CHOP Antibody [NBP2-49550] - Staining of human thyroid gland shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: GADD153/CHOP Antibody [NBP2-49550]

Immunohistochemistry-Paraffin: GADD153/CHOP Antibody [NBP2-49550]

Immunohistochemistry-Paraffin: GADD153/CHOP Antibody [NBP2-49550] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: GADD153/CHOP Antibody [NBP2-49550]

Immunohistochemistry-Paraffin: GADD153/CHOP Antibody [NBP2-49550]

Immunohistochemistry-Paraffin: GADD153/CHOP Antibody [NBP2-49550] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
GADD153/CHOP Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: GADD153/CHOP Antibody - BSA Free [NBP2-49550]

Chromatin Immunoprecipitation-exo-Seq: GADD153/CHOP Antibody - BSA Free [NBP2-49550]

ChIP-Exo-Seq composite graph for Anti-DDIT3 (NBP2-49550) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for GADD153/CHOP Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GADD153

GADD153 encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.

Long Name

Growth Arrest and DNA Damage-inducible Protein GADD153

Alternate Names

CEBP zeta, CHOP, CHOP10, DDIT3

Gene Symbol

DDIT3

Additional GADD153 Products

Product Documents for GADD153/CHOP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GADD153/CHOP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GADD153/CHOP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GADD153/CHOP Antibody - BSA Free and earn rewards!

Have you used GADD153/CHOP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies