GAL3ST3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62277

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GAL3ST3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GAL3ST3(galactose-3-O-sulfotransferase 3) The peptide sequence was selected form the C terminal of GAL3ST3. Peptide sequence VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GAL3ST3 Antibody - BSA Free

Western Blot: GAL3ST3 Antibody [NBP1-62277]

Western Blot: GAL3ST3 Antibody [NBP1-62277]

Western Blot: GAL3ST3 Antibody [NBP1-62277] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Applications for GAL3ST3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GAL3ST3

GAL3ST3 is a member of the galactose-3-O-sulfotransferase protein family. It catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 (Gal-beta-1-4GlcNAc-R) oligosaccharides and core-2-branched O-glycans, but not on type 1 or core-1-branched structures. This gene, which has also been referred to as GAL3ST2, is different from the GAL3ST2 gene located on chromosome 2 that encodes a related enzyme with distinct tissue distribution and substrate specificities, compared to galactose-3-O-sulfotransferase 3.This gene encodes a member of the galactose-3-O-sulfotransferase protein family. The product of this gene catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 (Gal-beta-1-4GlcNAc-R) oligosaccharides and core-2-branched O-glycans, but not on type 1 or core-1-branched structures. This gene, which has also been referred to as GAL3ST2, is different from the GAL3ST2 gene located on chromosome 2 that encodes a related enzyme with distinct tissue distribution and substrate specificities, compared to galactose-3-O-sulfotransferase 3.

Alternate Names

Beta-galactose-3-O-sulfotransferase 3, EC 2.8.2.-, GAL3ST2galactose 3'-sulfotransferase, Gal3ST3, GAL3ST-3, galactose-3-O-sulfotransferase 3, Gal-beta-1, 3-GalNAc 3'-sulfotransferase 3, galbeta1-3GalNAc 3'-sulfotransferase 3, MGC142112, MGC142114

Gene Symbol

GAL3ST3

OMIM

NP_149025 (Human)

UniProt

Q96A11 (Human)

Additional GAL3ST3 Products

Product Documents for GAL3ST3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GAL3ST3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GAL3ST3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GAL3ST3 Antibody - BSA Free and earn rewards!

Have you used GAL3ST3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies