Galectin-4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48605

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Galectin-4 Antibody - BSA Free (NBP2-48605) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Galectin-4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605]

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605]

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605] - Staining in human colon and liver tissues using anti-LGALS4 antibody. Corresponding LGALS4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605]

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605]

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605] - Staining of human colon, kidney, liver and rectum using Anti-LGALS4 antibody NBP2-48605 (A) shows similar protein distribution across tissues to independent antibody NBP2-48606 (B).
Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605]

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605]

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605] - Staining of human kidney.
Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605]

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605]

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605] - Staining of human colon shows high expression.
Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605]

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605]

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605]

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605]

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605] - Staining of human rectum.
Galectin-4 Antibody

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605] -

Immunohistochemistry-Paraffin: Galectin-4 Antibody [NBP2-48605] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for Galectin-4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Galectin-4

Galectins are a family of soluble beta-galactoside-binding animal lectins that modulate cell-to-cell adhesion and cell-to-extracellular matrix (ECM) interactions and play a role in tumor progression, pre-mRNA splicing and apoptosis. One member of this family, Galectin-4, also known as Gal-4, L36 or LGALS4 maps to human chromosome 19q13.13 and encodes a 36-37 kDa protein. The Galectin-4 protein is composed of 323 amino acids and contains two homologous carbohydrate recognition domains (CRD) and all amino acids typically conserved in the galectin family. Expression of Galectin-4 correlates with the malignant potential of human hepatocellular carcinoma (HCC) and is differentially regulated depending on cell-cell contact, serum growth factors, cell growth and cell differentiation status. Galectin-4 expression is detected in epithelial cells of the colon, rectum, intestine, and in HT29 and LS174T cell lines. Galectin-4 is underexpressed in colorectal cancer and is preferentially upregulated in cells prone to peritoneal dissemination.

Alternate Names

GAL4, Galectin4, LGALS4

Gene Symbol

LGALS4

Additional Galectin-4 Products

Product Documents for Galectin-4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Galectin-4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Galectin-4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Galectin-4 Antibody - BSA Free and earn rewards!

Have you used Galectin-4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...