Gamma Adaptin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57633

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Gamma Adaptin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to AP1G1(adaptor-related protein complex 1, gamma 1 subunit) The peptide sequence was selected from the C terminal of AP1G1. Peptide sequence DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Gamma Adaptin Antibody - BSA Free

Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Human Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml AP1G1 is supported by BioGPS gene expression data to be expressed in HepG2.
Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Jurkat, Antibody Dilution: 1.0 ug/ml AP1G1 is supported by BioGPS gene expression data to be expressed in Jurkat.

Applications for Gamma Adaptin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Gamma Adaptin

Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. AP1G1 is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

Adapter-related protein complex 1 subunit gamma-1, Adaptor protein complex AP-1 subunit gamma-1, adaptor-related protein complex 1, gamma 1 subunit, ADTGclathrin assembly protein complex 1 gamma large chain, AP-1 complex subunit gamma-1, CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1, Clathrin assembly protein complex 1 gamma-1 large chain, gamma adaptin, gamma1-adaptin, golgi adaptor HA1/AP1 adaptin gamma subunit, Golgi adaptor HA1/AP1 adaptin subunit gamma-1, MGC18255

Gene Symbol

AP1G1

UniProt

O43747 (Human)

Additional Gamma Adaptin Products

Product Documents for Gamma Adaptin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Gamma Adaptin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Gamma Adaptin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Gamma Adaptin Antibody - BSA Free and earn rewards!

Have you used Gamma Adaptin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies