GAS2L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82226

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GAS2L1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of GAS2L1. Peptide sequence: TPVSLRSTKEGPETPPRPRDQLPPHPRSRRYSGDSDSSASSAQSGPLGTR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GAS2L1 Antibody - BSA Free

Western Blot: GAS2L1 Antibody [NBP2-82226]

Western Blot: GAS2L1 Antibody [NBP2-82226]

Western Blot: GAS2L1 Antibody [NBP2-82226] - WB Suggested Anti-GAS2L1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Spleen

Applications for GAS2L1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GAS2L1

GAS2L1 is encoded by this gene, a member of the GAS2 family, is similar in sequence to the mouse protein Gas2, an actin-associated protein expressed at high levels in growth-arrested cells. Expression of the mouse Gas2 gene is negatively regulated by serum and growth factors. Three transcript variants encoding two different isoforms have been found for this gene.

Alternate Names

GAR22Growth arrest-specific protein 2-like 1, GAS2-like protein 1, GAS2-related protein on chromosome 22, growth arrest-specific 2 like 1, MGC17243

Gene Symbol

GAS2L1

Additional GAS2L1 Products

Product Documents for GAS2L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GAS2L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GAS2L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GAS2L1 Antibody - BSA Free and earn rewards!

Have you used GAS2L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies