GATE-16/GABARAPL2 Antibody (8Z8M8)

Novus Biologicals | Catalog # NBP3-16832

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8Z8M8 expressed in HEK293
View all GATE-16 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 38-117 of human GATE-16/GABARAPL2 (P60520). GSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GATE-16/GABARAPL2 Antibody (8Z8M8)

Western Blot: GATE-16/GABARAPL2 Antibody (8Z8M8) [NBP3-16832]

Western Blot: GATE-16/GABARAPL2 Antibody (8Z8M8) [NBP3-16832]

Western Blot: GATE-16/GABARAPL2 Antibody (8Z8M8) [NBP3-16832] - Western blot analysis of extracts of various cell lines, using GATE-16/GABARAPL2 Rabbit mAb (NBP3-16832) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for GATE-16/GABARAPL2 Antibody (8Z8M8)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GATE-16

GABARAPL2, also known as GATE-16, is involved in intra-Golgi traffic and belongs to the MAP1 LC3 family. GABARAPL2 modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. GABARAPL2 first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. GABARAPL2 interacts with GABRG2, NSF, GOSR1 and beta-tubulin. The subcellular location of GABARAPL2 is the Golgi apparatus. GABARAPL2 is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle, and is expressed at very low levels in lung, thymus and small intestine.

Long Name

Golgi-associated ATPase Enhancer of 16 kDa

Alternate Names

Apg8p2, ATG8C, FLC3A, GABARAPL2, GATE16, GEF2

Gene Symbol

GABARAPL2

Additional GATE-16 Products

Product Documents for GATE-16/GABARAPL2 Antibody (8Z8M8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GATE-16/GABARAPL2 Antibody (8Z8M8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GATE-16/GABARAPL2 Antibody (8Z8M8)

There are currently no reviews for this product. Be the first to review GATE-16/GABARAPL2 Antibody (8Z8M8) and earn rewards!

Have you used GATE-16/GABARAPL2 Antibody (8Z8M8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for GATE-16/GABARAPL2 Antibody (8Z8M8)

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am currently interested in detecting GABARAPL2 by immunofluorescence. Do you have an antibody that I could try out for immunofluorescence

    A:

    Here is the link using our search bar and filters

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies