GCAP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79774

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GCAP2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human GUCA1B. Peptide sequence SGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GCAP2 Antibody - BSA Free

Western Blot: GCAP2 Antibody [NBP1-79774]

Western Blot: GCAP2 Antibody [NBP1-79774]

Western Blot: GCAP2 Antibody [NBP1-79774] - U937 cell lysate, concentration 0.2-1 ug/ml.

Applications for GCAP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GCAP2

Guanylate cyclase-activating proteins (GCAPs) are calcium binding proteins that belong to the calmodulin superfamily. GCAPs without calcium are responsible for activation of photoreceptor guanylate cyclase during light adaptation. Studies have shown that the addition or subtraction of Ca2+ results in major conformational changes and the activation/deactivation of GCAP 1 and GCAP 2. It has been demonstrated that both GCAP 1 and 2 act on guanylate cyclase similarly and have approximately 50% homology between the two forms. GCAP-1 is predominantly localized in the photoreceptor outer segments, while GCAP 2 is found in retina samples.

Alternate Names

DKFZp686E1183, GCAP 2, GCAP2guanylate cyclase-activating protein, photoreceptor 2, Guanylate cyclase activator 1B, guanylate cyclase activator 1B (retina), guanylyl cyclase-activating protein 2, GUCA2, RP48

Gene Symbol

GUCA1B

UniProt

NP_002089 (Human)

Additional GCAP2 Products

Product Documents for GCAP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GCAP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GCAP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GCAP2 Antibody - BSA Free and earn rewards!

Have you used GCAP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies