GGA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55191

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDK

Reactivity Notes

Rat 82%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GGA3 Antibody - BSA Free

Western Blot: GGA3 Antibody [NBP2-55191]

Western Blot: GGA3 Antibody [NBP2-55191]

Western Blot: GGA3 Antibody [NBP2-55191] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: GGA3 Antibody [NBP2-55191]

Immunocytochemistry/ Immunofluorescence: GGA3 Antibody [NBP2-55191]

Immunocytochemistry/Immunofluorescence: GGA3 Antibody [NBP2-55191] - Staining of human cell line RH-30 shows localization to the Golgi apparatus.

Applications for GGA3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GGA3

GGA3 encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network (TGN) and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma- adaptins. GGA3 mediates the ARF-dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic acidic cluster-dileucine (AC-LL) motif. Alternative splicing of this gene results in two transcript variants.

Alternate Names

ADP-ribosylation factor-binding protein GGA3, golgi associated, gamma adaptin ear containing, ARF binding protein 3, golgi-associated, gamma adaptin ear containing, ARF binding protein 3, KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3

Gene Symbol

GGA3

Additional GGA3 Products

Product Documents for GGA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GGA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GGA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GGA3 Antibody - BSA Free and earn rewards!

Have you used GGA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...