GHRH Antibody (8G5Y9)

Novus Biologicals | Catalog # NBP3-33413

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 8G5Y9
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GHRH (NP_066567.1).

Sequence:
MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GHRH Antibody (8G5Y9)

GHRH Antibody (8G5Y9)

Western Blot: GHRH Antibody (8G5Y9) [NBP3-33413] -

Western Blot: GHRH Antibody (8G5Y9) [NBP3-33413] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with GHRH using GHRH Rabbit mAb at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for GHRH Antibody (8G5Y9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GHRH

GHRH, also known as Somatoliberin or Growth hormone-releasing hormone, has a 108 amino acid isoform and a 107 amino acid isoform that are 12 kDa, is produced by the hypothalamus and its main function is to stimulate growth hormone release. Disease research is being performed on this proteins involvement in gigantism, isolated growth hormone deficiency due to defect in ghrf, dwarfism, gigantism due to ghrf hypersecretion, zollinger-ellison syndrome, anorexia, nervosa, multiple endocrine neoplasia, polycystic ovary syndrome, short stature, Cushing's syndrome, hypopituitarism, diabetes insipidus, panic disorder, hypothyroidism, somatostatinoma, acromegaly, vipoma, pituitary adenoma, Prader-Willi syndrome, hyperprolactinemia, cancer, lipodystrophy, hypogonadism, diabetes mellitus, and Pseudohypoparathyroidism. This protein has been involved in 55 different pathways such as nuclear receptor activation by vitamin-A, Paxillin Interactions, telomerase components in cell signaling, mitochondrial apoptosis, molecular mechanisms of cancer, antioxidant action of vitamin-C, eIF2 pathway, intracellular calcium signaling, JNK pathway, apoptotic pathways in synovial fibroblasts, ERK5 signaling, Tec kinases signaling, GSK3 signaling, and cellular apoptosis pathway where it interacts with GHRHR, DPP4, FAP, ADCYAP1R1, POMC, NPS, MC4R, ADRB1, and 50 other proteins.

Alternate Names

GHRFsomatocrinin, GRF, growth hormone releasing hormone, Growth hormone-releasing factor, Growth hormone-releasing hormone, INN, MGC119781, sermorelin, Somatocrinin, somatoliberin, somatorelin

Gene Symbol

GHRH

Additional GHRH Products

Product Documents for GHRH Antibody (8G5Y9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GHRH Antibody (8G5Y9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GHRH Antibody (8G5Y9)

There are currently no reviews for this product. Be the first to review GHRH Antibody (8G5Y9) and earn rewards!

Have you used GHRH Antibody (8G5Y9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...