GIMAP5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59485

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GIMAP5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GIMAP5(GTPase, IMAP family member 5) The peptide sequence was selected from the middle region of GIMAP5 (NP_060854). Peptide sequence CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GIMAP5 Antibody - BSA Free

Western Blot: GIMAP5 Antibody [NBP1-59485]

Western Blot: GIMAP5 Antibody [NBP1-59485]

Western Blot: GIMAP5 Antibody [NBP1-59485] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.

Applications for GIMAP5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GIMAP5

GIMAP5 belongs to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.

Alternate Names

FLJ11296, GTPase, IMAP family member 5, hIAN5, HIMAP3, IAN4, IAN4L1IROD, IAN5, IAN-5, IMAP3GTPase IMAP family member 5, immune associated nucleotide 4 like 1, immune associated nucleotide 4 like 1 (mouse), immunity associated protein 3, Immunity-associated nucleotide 4-like 1 protein, Immunity-associated nucleotide 5 protein, Immunity-associated protein 3, inhibitor of radiation- and OA-induced apoptosis, Irod/Ian5

Entrez Gene IDs

55340 (Human)

Gene Symbol

GIMAP5

UniProt

Q96F15 (Human)

Additional GIMAP5 Products

Product Documents for GIMAP5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GIMAP5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GIMAP5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GIMAP5 Antibody - BSA Free and earn rewards!

Have you used GIMAP5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies