Glucose Transporter GLUT8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59812

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Glucose Transporter GLUT8 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC2A8 (solute carrier family 2, facilitated glucose transporter, member 8). The peptide sequence was selected from the middle region of SLC2A8. Peptide sequence VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Glucose Transporter GLUT8 Antibody - BSA Free

Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812]

Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812]

Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812]

Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812]

Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812]

Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812]

Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Applications for Glucose Transporter GLUT8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glucose Transporter GLUT8

SLC2A8 is the insulin-regulated facilitative glucose transporter.SLC2A8 binds cytochalasin B in a glucose-inhibitable manner.SLC2A8 seems to be a dual-specific sugar transporter as it is inhibitable by fructose.

Alternate Names

GLUT-8, GLUT8solute carrier family 2 (facilitated glucose transporter) member 8, GLUTX1facilitated glucose transporter member 8, solute carrier family 2 (facilitated glucose transporter), member 8

Gene Symbol

SLC2A8

UniProt

Q9NY64 (Human)

Additional Glucose Transporter GLUT8 Products

Product Documents for Glucose Transporter GLUT8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glucose Transporter GLUT8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glucose Transporter GLUT8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glucose Transporter GLUT8 Antibody - BSA Free and earn rewards!

Have you used Glucose Transporter GLUT8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies