Glutamate Receptor 4 Antibody (4M5D0)

Novus Biologicals | Catalog # NBP3-16445

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4M5D0 expressed in HEK293
View all GluR4 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 800-902 of human Glutamate Receptor 4 (P48058). SGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDLP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutamate Receptor 4 Antibody (4M5D0)

Western Blot: Glutamate Receptor 4 Antibody (4M5D0) [NBP3-16445]

Western Blot: Glutamate Receptor 4 Antibody (4M5D0) [NBP3-16445]

Western Blot: Glutamate Receptor 4 Antibody (4M5D0) [NBP3-16445] - Western blot analysis of extracts of various cell lines, using Glutamate Receptor 4Rabbit mAb (NBP3-16445) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Applications for Glutamate Receptor 4 Antibody (4M5D0)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GluR4

Glutamate receptors mediate most excitatory neurotransmission in the brain and play an important role in neural plasticity, neural development and neurodegeneration. Ionotropic glutamate receptors are categorized into NMDA receptors and kainate/AMPA receptors, both of which contain glutamategated, caution-specific ion channels. Kainate/AMPA receptors are co-localized with NMDA receptors in many synapses and consist of seven structurally related subunits designated GluR-1 to -7. The kainate/AMPA receptors are primarily responsible for the fast excitatory neuro-transmission by glutamate, whereas the NMDA receptors are functionally characterized by a slow kinetic and a high permeability for Ca2+ ions. The NMDA receptors consist of five subunits: epsilion 1, 2, 3, 4 and one zeta subunit. The zeta subunit is expressed throughout the brain stem, whereas the four epsilon subunits display limited distribution.

Long Name

Glutamate Receptor 4

Alternate Names

GluA4, GLURD

Gene Symbol

GRIA4

Additional GluR4 Products

Product Documents for Glutamate Receptor 4 Antibody (4M5D0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glutamate Receptor 4 Antibody (4M5D0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glutamate Receptor 4 Antibody (4M5D0)

There are currently no reviews for this product. Be the first to review Glutamate Receptor 4 Antibody (4M5D0) and earn rewards!

Have you used Glutamate Receptor 4 Antibody (4M5D0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies