Glutamate Receptor 6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87508

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Glutamate Receptor 6. Peptide sequence: LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Glutamate Receptor 6 Antibody - BSA Free

Western Blot: Glutamate Receptor 6 Antibody [NBP2-87508]

Western Blot: Glutamate Receptor 6 Antibody [NBP2-87508]

Western Blot: Glutamate Receptor 6 Antibody [NBP2-87508] - WB Suggested Anti-GRIK2 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate

Applications for Glutamate Receptor 6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GluR6/GRIK2

Glutamate receptors mediate most excitatory neurotransmission in the brain and play an important role in neural plasticity, neural development and neurodegeneration. Ionotropic glutamate receptors are categorized into NMDA receptors and kainate/AMPA receptors, both of which contain glutamategated, caution-specific ion channels. Kainate/AMPA receptors are co-localized with NMDA receptors in many synapses and consist of seven structurally related subunits designated GluR-1 to -7. The kainate/AMPA receptors are primarily responsible for the fast excitatory neuro-transmission by glutamate, whereas the NMDA receptors are functionally characterized by a slow kinetic and a high permeability for Ca2+ ions. The NMDA receptors consist of five subunits: epsilion 1, 2, 3, 4 and one zeta subunit. The zeta subunit is expressed throughout the brain stem, whereas the four epsilon subunits display limited distribution.

Long Name

Glutamate Receptor 6

Alternate Names

EAA4, GLR6, GluK2, GLUK6, MRT6

Gene Symbol

GRIK2

Additional GluR6/GRIK2 Products

Product Documents for Glutamate Receptor 6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutamate Receptor 6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glutamate Receptor 6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutamate Receptor 6 Antibody - BSA Free and earn rewards!

Have you used Glutamate Receptor 6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...