Glutathione Reductase Antibody (2J5N9)

Novus Biologicals | Catalog # NBP3-16436

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2J5N9 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 423-522 of human Glutathione Reductase (P00390). TVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutathione Reductase Antibody (2J5N9)

Western Blot: Glutathione Reductase Antibody (2J5N9) [NBP3-16436]

Western Blot: Glutathione Reductase Antibody (2J5N9) [NBP3-16436]

Western Blot: Glutathione Reductase Antibody (2J5N9) [NBP3-16436] - Western blot analysis of extracts of various cell lines, using Glutathione Reductase Rabbit mAb (NBP3-16436) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for Glutathione Reductase Antibody (2J5N9)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glutathione Reductase

Glutathione reductase (GR) is a member of pyridine nucleotide-disulfideoxidoreductases, which includes the closely related enzymes thioredoxin reductase, lipoamide dehydrogenase, trypanothione reductase and mercuric ion reductase. GR is a cytoplasmic flavoenzyme widely distributed in aerobic organisms. The dimeric protein is composed of two identical subunits, each containing 1 FAD and 1 redox-active disulfide/dithiol as components of the catalytic apparatus. It plays a role in maintaining glutathione(GSH) in its reduced form by catalyzing the reduction of glutathione disulfide (GSSG): GSSG + NADPH + H+ ->2GSH + NADP+. In mosteukaryotic cells, GR maintains the ratio of [GSH]/[GSSG], and participates in several vital functions such as the detoxification of reactive oxygen species as well as protein and DNA biosynthesis.

Alternate Names

GLUR, GRase, GRD1, GSR, HEL-752

Gene Symbol

GSR

Additional Glutathione Reductase Products

Product Documents for Glutathione Reductase Antibody (2J5N9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutathione Reductase Antibody (2J5N9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Glutathione Reductase Antibody (2J5N9)

There are currently no reviews for this product. Be the first to review Glutathione Reductase Antibody (2J5N9) and earn rewards!

Have you used Glutathione Reductase Antibody (2J5N9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...