Glutathione S Transferase kappa 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89727

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Glutathione S Transferase kappa 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVN

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutathione S Transferase kappa 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727]

Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727]

Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Analysis in human duodenum and pancreas tissues using NBP1-89727 antibody. Corresponding Glutathione S Transferase kappa 1 RNA-seq data are presented for the same tissues.
Glutathione S Transferase kappa 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody - BSA Free [NBP1-89727]

Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody - BSA Free [NBP1-89727]

Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Glutathione S Transferase kappa 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody - BSA Free [NBP1-89727]

Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody - BSA Free [NBP1-89727]

Staining of human pancreas shows weak granular cytoplasmic positivity in islets of Langerhans as ecxpected.
Glutathione S Transferase kappa 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody - BSA Free [NBP1-89727]

Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody - BSA Free [NBP1-89727]

Staining of human skeletal muscle shows weak granular cytoplasmic positivity in myocytes as expected.
Glutathione S Transferase kappa 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody - BSA Free [NBP1-89727]

Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody - BSA Free [NBP1-89727]

Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Glutathione S Transferase kappa 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody - BSA Free [NBP1-89727]

Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody - BSA Free [NBP1-89727]

Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Applications for Glutathione S Transferase kappa 1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glutathione S Transferase kappa 1

Glutathione transferases (GSTs) are a superfamily of enzymes that play a vital functional role in the cellular detoxification process. They catalyze the conjugation of the thiol group of glutathione (GSH) to the electrophilic groups of a wide range of hydrophobic substrates, leading to an easier removal of the latter from the cells (1) The Kappa class of GSTs comprises soluble enzymes originally isolated from the mitochondrial matrix of rats. Gsk1 catalyses some typical GST reactions, it has been proposed that it is structurally distinct from other classes of cytosolic GSTs (2). Gsk1 has been identified in rat, mouse, and human. The C terminus of Gsk1 was essential for localization of the protein to peroxisomes, and the C-terminal sequence Ala-Arg-Leu represents a peroxisome targeting signal (3).

Alternate Names

EC 2.5.1.18, glutathione S-transferase k1, glutathione S-transferase kappa 1, Glutathione S-transferase subunit 13, glutathione S-transferase subunit 13 homolog, GST, GST 13-13, GST class-kappa, GST13, GST13-13, GSTK1-1, hGSTK1

Gene Symbol

GSTK1

Additional Glutathione S Transferase kappa 1 Products

Product Documents for Glutathione S Transferase kappa 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glutathione S Transferase kappa 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Glutathione S Transferase kappa 1 Antibody - BSA Free

Customer Reviews for Glutathione S Transferase kappa 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutathione S Transferase kappa 1 Antibody - BSA Free and earn rewards!

Have you used Glutathione S Transferase kappa 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Glutathione S Transferase kappa 1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am looking for the antibody that recognizes protein, GSH transferase kappa from bovine.

    A:

    The immunogen for NBP1-89727 shares 90% similarity with bovine GSTK1, so is predicted to cross-react. The immunogen for NBP1-57752 shares 88% similarity with bovine GSTK1, so is predicted to cross-react. I am not sure what application you are looking to use this in. If you are looking at Western blot, either antibody would work. If you are looking at any tissue staining, then I would recommend NBP1-89727. While we cannot guarantee this antibody for use in bovine samples, if you would be interested in testing this novel species, please take a look at our Innovator's Reward program.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies