New

Glypican 6 Recombinant Protein Antigen

Name: Glypican 6 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP3-24878PEP
Price: 279 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-24878PEP

Submit a review

Product Documents

100% Guarantee

Product Specifications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Applications

Antibody Competition

View all Glypican 6 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glypican 6

Source: E.coli

Amino Acid Sequence: AYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDSSAAQRGHSLLSWSLTCIVLAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24878It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-24878PEP

Formulation	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -20C. Avoid freeze-thaw cycles.

Background: Glypican 6

The glypicans comprise a family of glycosylphosphatidylinositol-anchored heparan sulfate proteoglycans, and they have been implicated in the control of cell growth and cell division. The glypican encoded by this gene is a putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases. [provided by RefSeq]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no quality transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

Alternate Names

GPC6

Gene Symbol

GPC6

Additional Glypican 6 Products

Product Documents for Glypican 6 Recombinant Protein Antigen

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glypican 6 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.