GNG11 Antibody (2H5) - Azide and BSA Free

Novus Biologicals | Catalog # H00002791-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Proximity Ligation Assay

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2H5

Format

Azide and BSA Free
View all GNG11 Primary Antibodies »

Product Specifications

Immunogen

GNG11 (NP_004117.1, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGS

Specificity

GNG11 - guanine nucleotide binding protein (G protein), gamma 11 (2H5)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for GNG11 Antibody (2H5) - Azide and BSA Free

Proximity Ligation Assay: GNG11 Antibody (2H5) [H00002791-M01]

Proximity Ligation Assay: GNG11 Antibody (2H5) [H00002791-M01]

Proximity Ligation Assay: GNG11 Antibody (2H5) [H00002791-M01] - Analysis of protein-protein interactions between SMURF1 and GNG11. HeLa cells were stained with anti-SMURF1 rabbit purified polyclonal 1:1200 and anti-GNG11 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Sandwich ELISA: GNG11 Antibody (2H5) [H00002791-M01] - Detection limit for recombinant GST tagged GNG11 is approximately 3ng/ml as a capture antibody.

Applications for GNG11 Antibody (2H5) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: GNG11

This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq]

Alternate Names

GNGT11G protein gamma-11 subunit, guanine nucleotide binding protein (G protein), gamma 11, guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-11 subunit, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11

Entrez Gene IDs

2791 (Human)

Gene Symbol

GNG11

UniProt

NP_004117 (Human)

Additional GNG11 Products

Product Documents for GNG11 Antibody (2H5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GNG11 Antibody (2H5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GNG11 Antibody (2H5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GNG11 Antibody (2H5) - Azide and BSA Free and earn rewards!

Have you used GNG11 Antibody (2H5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies