GNGT1 Antibody (1F8) - Azide and BSA Free

Novus Biologicals | Catalog # H00002792-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1F8

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

GNGT1 (AAH29367, 1 a.a. ~ 74 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS

Specificity

GNGT1 - guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (1F8)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for GNGT1 Antibody (1F8) - Azide and BSA Free

Western Blot: GNGT1 Antibody (1F8) [H00002792-M01]

Western Blot: GNGT1 Antibody (1F8) [H00002792-M01]

Western Blot: GNGT1 Antibody (1F8) [H00002792-M01] - Analysis of GNGT1 expression in transfected 293T cell line by GNGT1 monoclonal antibody (M01), clone 1F8.Lane 1: GNGT1 transfected lysate(8.5 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: GNGT1 Antibody (1F8) [H00002792-M01] - Detection limit for recombinant GST tagged GNGT1 is 1 ng/ml as a capture antibody.

Applications for GNGT1 Antibody (1F8) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: GNGT1

Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM]

Alternate Names

GNG1, guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 1, guanine nucleotide-binding protein G(T) subunit gamma-T1, Transducin gamma chain

Entrez Gene IDs

2792 (Human)

Gene Symbol

GNGT1

Additional GNGT1 Products

Product Documents for GNGT1 Antibody (1F8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GNGT1 Antibody (1F8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GNGT1 Antibody (1F8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GNGT1 Antibody (1F8) - Azide and BSA Free and earn rewards!

Have you used GNGT1 Antibody (1F8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...