GOLGA5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60047

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GOLGA5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GOLGA5(golgi autoantigen, golgin subfamily a, 5) The peptide sequence was selected from the N terminal of GOLGA5. Peptide sequence FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS. The peptide sequence for this immunogen was taken from within the described region.

Marker

Golgi Apparatus Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GOLGA5 Antibody - BSA Free

Western Blot: GOLGA5 Antibody [NBP1-60047]

Western Blot: GOLGA5 Antibody [NBP1-60047]

Western Blot: GOLGA5 Antibody [NBP1-60047] - Human 293T, Antibody Dilution: 1.0 ug/ml GOLGA5 is supported by BioGPS gene expression data to be expressed in HEK293T.
Western Blot: GOLGA5 Antibody [NBP1-60047]

Western Blot: GOLGA5 Antibody [NBP1-60047]

Western Blot: GOLGA5 Antibody [NBP1-60047] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for GOLGA5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GOLGA5

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. GOLGA5 is a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5.The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

Cell proliferation-inducing gene 31 protein, golgi autoantigen, golgin subfamily a, 5, golgin A5, Golgin subfamily A member 5, golgin-84, GOLIM5, Protein Ret-II, PTC5, RET-fused gene 5 protein, RETII, ret-II, rfg5, RFG5golgi integral membrane protein 5

Gene Symbol

GOLGA5

UniProt

Q8TBA6 (Human)

Additional GOLGA5 Products

Product Documents for GOLGA5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GOLGA5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GOLGA5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GOLGA5 Antibody - BSA Free and earn rewards!

Have you used GOLGA5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies