GPM6A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85000

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of GPM6A. Peptide sequence: IAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GPM6A Antibody - BSA Free

Western Blot: GPM6A Antibody [NBP2-85000]

Western Blot: GPM6A Antibody [NBP2-85000]

Western Blot: GPM6A Antibody [NBP2-85000] - Lanes: Lane1: 250ug rat hippocampal culture neurons. Lane2: 200ug rat hippocampal culture neurons. Lane3: 100ug rat hippocampal culture neurons. Lane4: 50ug rat hippocampal culture neurons. Primary Antibody Dilution: 1:1000. Secondary Antibody: Anti-rabbit HRP. Secondary Antibody Dilution: 1:8000. Gene Name: GPM6A. Submitted by: Anonymous.
Immunohistochemistry: GPM6A Antibody [NBP2-85000]

Immunohistochemistry: GPM6A Antibody [NBP2-85000]

Immunohistochemistry: GPM6A Antibody [NBP2-85000] - Primary Antibody Dilution: 1:250. Secondary Antibody: Anti-rabbit-AlexaFluor 488. Secondary Antibody Dilution: 1:1000. Color/Signal Descriptions: GPM6A: Green DAPI: Blue. Gene Name: GPM6A. Submitted by: Anonymous
Western Blot: GPM6A Antibody [NBP2-85000]

Western Blot: GPM6A Antibody [NBP2-85000]

Western Blot: GPM6A Antibody [NBP2-85000] - Host: Rabbit. Target Name: GPM6A. Antibody Dilution: 1.0ug/ml. Sample Type: Human brain
Western Blot: GPM6A Antibody [NBP2-85000]

Western Blot: GPM6A Antibody [NBP2-85000]

Western Blot: GPM6A Antibody [NBP2-85000] - Host: Rabbit. Target: GPM6A. Positive control (+): Human Liver (LI). Negative control (-): Human Stomach Tumor (T-ST). Antibody concentration: 3ug/ml
Western Blot: GPM6A Antibody [NBP2-85000]

Western Blot: GPM6A Antibody [NBP2-85000]

Western Blot: GPM6A Antibody [NBP2-85000] - Host: Rabbit. Target Name: GPM6A. Sample Tissue: Human Brain. Antibody Dilution: 1ug/ml
Western Blot: GPM6A Antibody [NBP2-85000]

Western Blot: GPM6A Antibody [NBP2-85000]

Western Blot: GPM6A Antibody [NBP2-85000] - Lanes: Lane1: 400ug rat hippocampal. Lane2: 300ug rat hippocampal. Lane3: 200ug rat hippocampal. Lane4: 100ug rat hippocampal. Primary Antibody Dilution: 1:1000. Secondary Antibody: Anti-rabbit HRP. Secondary Antibody Dilution: 1:8000. Gene Name: GPM6A. Submitted by: Anonymous.
Immunohistochemistry: GPM6A Antibody [NBP2-85000]

Immunohistochemistry: GPM6A Antibody [NBP2-85000]

Immunohistochemistry: GPM6A Antibody [NBP2-85000] - Primary Antibody Dilution: 1:250. Secondary Antibody: Anti-rabbit-AlexaFluor 488. Secondary Antibody Dilution: 1:1000. Color/Signal Descriptions: GPM6A: Green DAPI: Blue. Gene Name: GPM6A. Submitted by: Anonymous

Applications for GPM6A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPM6A

Long Name

Glycoprotein M6A

Alternate Names

M6A

Gene Symbol

GPM6A

Additional GPM6A Products

Product Documents for GPM6A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GPM6A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GPM6A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPM6A Antibody - BSA Free and earn rewards!

Have you used GPM6A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...