GPR103 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85002

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GPR103 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human GPR103. Peptide sequence: FSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAENS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GPR103 Antibody - BSA Free

Western Blot: GPR103 Antibody [NBP2-85002]

Western Blot: GPR103 Antibody [NBP2-85002]

Western Blot: GPR103 Antibody [NBP2-85002] - WB Suggested Anti-QRFPR Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

Applications for GPR103 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPR103

GPR103 is a 455 amino acid protein with highest expression in the brain, retina, trigeminal ganglion, hypothalamus and vestibular nucleus. In peripheral tissues, GPR103 is expressed only in the heart, kidney and testis. GPR103 may regulate adrenal function. A hypothalamic neuropeptide of the RFamide family (26RFa) acts as an endogenous ligand for GPR103.

Long Name

G Protein-coupled Receptor 103

Alternate Names

AQ27, QRFPR, SP9155

Gene Symbol

QRFPR

Additional GPR103 Products

Product Documents for GPR103 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GPR103 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GPR103 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPR103 Antibody - BSA Free and earn rewards!

Have you used GPR103 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies