GPR154 Antibody (2F5) - Azide and BSA Free

Novus Biologicals | Catalog # H00387129-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2F5

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

GPR154 (NP_997056, 2 a.a. ~ 53 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL

Specificity

GPR154 - G protein-coupled receptor 154

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for GPR154 Antibody (2F5) - Azide and BSA Free

Western Blot: GPR154 Antibody (2F5) [H00387129-M01]

Western Blot: GPR154 Antibody (2F5) [H00387129-M01]

Western Blot: GPR154 Antibody (2F5) [H00387129-M01] - Detection against Immunogen (31.46 KDa).
ELISA: GPR154 Antibody (2F5) [H00387129-M01]

ELISA: GPR154 Antibody (2F5) [H00387129-M01]

ELISA: GPR154 Antibody (2F5) [H00387129-M01] - Detection limit for recombinant GST tagged GPR154 is approximately 0.03ng/ml as a capture antibody.

Applications for GPR154 Antibody (2F5) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: GPR154

This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Mutations in this gene have also been associated with this disease. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Alternate Names

G protein-coupled receptor 154, G protein-coupled receptor for asthma susceptibility, GPR154NPSR, GPRAASRT2, G-protein coupled receptor 154, G-protein coupled receptor for asthma susceptibility, G-protein coupled receptor PGR14, neuropeptide S receptor, neuropeptide S receptor 1, PGR14VRR1, vasopressin receptor-related receptor 1

Entrez Gene IDs

387129 (Human)

Gene Symbol

NPSR1

OMIM

608584 (Human)

Additional GPR154 Products

Product Documents for GPR154 Antibody (2F5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GPR154 Antibody (2F5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GPR154 Antibody (2F5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GPR154 Antibody (2F5) - Azide and BSA Free and earn rewards!

Have you used GPR154 Antibody (2F5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...