Recombinant Human GPR34 Protein

Novus Biologicals | Catalog # H00002857-G01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Applications

Affinity Purification
Loading...

Product Specifications

Description

An untagged recombinant protein corresponding to the amino acid sequence of (NP_005291.1) for Human GPR34

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

43.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Formulation, Preparation, and Storage

H00002857-G01
Preparation Method in vitro wheat germ expression system with proprietary liposome technology
Formulation 25 mM Tris-HCl pH8.0 in 2% glycerol.
Preservative Glycerol
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: GPR34

GPR34 is an Orphan-A GPCR with an unknown ligand. It is similar to the P2Y receptor subfamily. GPR34 has been reported to be expressed in the brain, particularly in caudate, frontal cortex, putamen, and thalamus, as well as in eye, liver, and testis. ESTs have been isolated from adipose, B-cell/lung/testis, eye, liver/spleen, placenta, tonsil, and uterus libraries.

Long Name

G Protein-coupled Receptor 34

Alternate Names

G protein-coupled receptor 34, probable G-protein coupled receptor 34

Gene Symbol

GPR34

Additional GPR34 Products

Product Documents for Recombinant Human GPR34 Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human GPR34 Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human GPR34 Protein

There are currently no reviews for this product. Be the first to review Recombinant Human GPR34 Protein and earn rewards!

Have you used Recombinant Human GPR34 Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...