GPR83 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82241

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GPR83 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GPR83. Peptide sequence: QEDRPPSPVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GPR83 Antibody - BSA Free

Western Blot: GPR83 Antibody [NBP2-82241]

Western Blot: GPR83 Antibody [NBP2-82241]

Western Blot: GPR83 Antibody [NBP2-82241] - WB Suggested Anti-GPR83 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 721_B cell lysate

Applications for GPR83 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPR83

GPCR GPR83 + GPR72 are members of the G protein-coupled receptor (GPCR) family. Members of this protein family contain seven putative transmembrane domains and may mediate signaling processes to the interior of the cell via activation of heterotrimeric G proteins. GPCR GPR72 has been reported in various regions of the brain.

Long Name

G Protein-coupled Receptor 83

Alternate Names

GIR, GPR72, RP39, RP82

Gene Symbol

GPR83

Additional GPR83 Products

Product Documents for GPR83 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GPR83 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Nutrition and Appetite
Obesity

Customer Reviews for GPR83 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPR83 Antibody - BSA Free and earn rewards!

Have you used GPR83 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies