GPR85 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82242

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GPR85 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR85. Peptide sequence: YFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GPR85 Antibody - BSA Free

Western Blot: GPR85 Antibody [NBP2-82242]

Western Blot: GPR85 Antibody [NBP2-82242]

Western Blot: GPR85 Antibody [NBP2-82242] - WB Suggested Anti-GPR85 Antibody. Titration: 1.0 ug/ml. Positive Control: NCI-H226 Whole CellGPR85 is supported by BioGPS gene expression data to be expressed in NCIH226
Immunohistochemistry-Paraffin: GPR85 Antibody [NBP2-82242]

Immunohistochemistry-Paraffin: GPR85 Antibody [NBP2-82242]

Immunohistochemistry-Paraffin: GPR85 Antibody [NBP2-82242] - Rabbit Anti-GPR85 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cortex. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec
Western Blot: GPR85 Antibody [NBP2-82242]

Western Blot: GPR85 Antibody [NBP2-82242]

Western Blot: GPR85 Antibody [NBP2-82242] - Host: Rabbit. Target Name: GPR85. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml

Applications for GPR85 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPR85

GPR85 has been reported to be expressed in several areas of human and rat CNS Matsumoto et al., 2000), as well as in genital organs. ESTs have been isolated from B-cell/lung/testis, brain, testis, and embryo libraries, as well as many mouse tissue libraries.

Long Name

G Protein-coupled Receptor 85

Alternate Names

SREB2

Gene Symbol

GPR85

Additional GPR85 Products

Product Documents for GPR85 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GPR85 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GPR85 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPR85 Antibody - BSA Free and earn rewards!

Have you used GPR85 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies